PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim04g015290.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 320aa    MW: 34929.2 Da    PI: 6.4487
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim04g015290.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.41.4e-324296155
             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        kprlrWt +LHerF++av+qLGG+ kAtPk+i+++m+vkgLtl h+kSHLQkYRl
  Sopim04g015290.0.1 42 KPRLRWTADLHERFIDAVTQLGGPSKATPKAIMRTMGVKGLTLFHLKSHLQKYRL 96
                        79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.7E-313997IPR009057Homeodomain-like
PROSITE profilePS5129410.8913999IPR017930Myb domain
TIGRFAMsTIGR015571.1E-234297IPR006447Myb domain, plants
SuperFamilySSF466895.55E-164298IPR009057Homeodomain-like
PfamPF002496.3E-84495IPR001005SANT/Myb domain
PfamPF143791.8E-16140185IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MFPRLIQSQE DEFIHGCDVN VGIHHHNRVN GDPCLVLTSD PKPRLRWTAD LHERFIDAVT  60
QLGGPSKATP KAIMRTMGVK GLTLFHLKSH LQKYRLGKQS QKDLDEASKD GLTATYSLES  120
PCSGGTPQQL PASDLNEGFE VKEALRAQME VQSKLHLQVE AEKHLQIRQD AEQRYITMLE  180
KACKMLADQF IGDVVTENHQ ETYQGLNTKT QLSPLCNPHG LCPSESADFV GVHGPEDVSP  240
RIHPQRTDCS TESCLTSHES PAGLPVEGSS PGGKKRGLSG DSTQASYVWG EADMRSSGVH  300
VLPVNCFGIS GSNVQNVSN*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU0743070.0CU074307.9 S.lycopersicum DNA sequence from clone LE_HBa-203L19 on chromosome 4, complete sequence.
GenBankHG9755160.0HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004236637.10.0PREDICTED: uncharacterized protein LOC101251768 isoform X1
SwissprotQ9SAK55e-50APL_ARATH; Myb family transcription factor APL
TrEMBLK4BQ320.0K4BQ32_SOLLC; Uncharacterized protein
STRINGSolyc04g015290.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA97642027
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.13e-69G2-like family protein